SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1LG17 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1LG17
Domain Number 1 Region: 31-76
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000209
Family Elafin-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V1LG17
Sequence length 80
Comment (tr|A0A0V1LG17|A0A0V1LG17_9BILA) Uncharacterized protein {ECO:0000313|EMBL:KRZ57982.1} KW=Complete proteome; Reference proteome OX=6335 OS=Trichinella nativa. GN=T02_7307 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MKYTILKLFLYLCIMNMTSAHLIWVSDASYNRFGRCPVFYGRMVPAVFRRDSCLTTAHCP
LGMTCCLTLTGRQCLYARSL
Download sequence
Identical sequences A0A0V0TLC0 A0A0V0WAL1 A0A0V1CWB3 A0A0V1LG17

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]