SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1N4Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1N4Y6
Domain Number 1 Region: 357-478
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 5.76e-33
Family cAMP-binding domain 0.00000516
Further Details:      
 
Domain Number 2 Region: 227-346
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.07e-33
Family cAMP-binding domain 0.0000052
Further Details:      
 
Domain Number 3 Region: 10-54
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1N4Y6
Sequence length 490
Comment (tr|A0A0V1N4Y6|A0A0V1N4Y6_9BILA) cAMP-dependent protein kinase regulatory subunit {ECO:0000313|EMBL:KRZ79053.1} KW=Complete proteome; Reference proteome OX=268474 OS=Trichinella papuae. GN=T10_7284 OC=Trichinellida; Trichinellidae; Trichinella.
Sequence
MSHQSAWARLCEDYLERHNISDLIKRALVRLCIAQPDDPVAFLSHYFQLLEKGENGFPEG
EPLRKWFHHVSRSDVLFEKRRRRTVRVCLCVVCVCVHVRLVCKRPMGNKLRKQVGTVVVG
KRHSDGAGPLPTEQAPSNKPPPTVVIQESSGDTSALPQQGTTAATSAESNKVSTLNQPSP
SESHDEEDLGAADSAGAADSKARSRRGAVSAEVYSEEDIANYVKKVVPKDEETKKALEKA
MCQNVLFAHLDENEKKDIFNAMFPVEANAGEVIIQQGDEGDNFYVIDSGEVEVFVNNKSV
TTIKENGSFGELALIYGTPRAATVLAKTRVKLWALDRDTYRRILMGSTIRKRKQYEEFLS
KVKILEDLDKWERLTVADALEPVTFEKGTHIVEQGQPGDNFFIILEGEAEVYQKRSEDSK
PELVGHLNPSEYFGEIALLLDRPRAATVVAKTALKCAKLDRARFERVMGPCSEILKRNIL
NYNSYVNLLT
Download sequence
Identical sequences A0A0V1N4Y6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]