SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V1Q1V2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V1Q1V2
Domain Number 1 Region: 91-196
Classification Level Classification E-value
Superfamily FAD-dependent thiol oxidase 1.44e-37
Family FAD-dependent thiol oxidase 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V1Q1V2
Sequence length 228
Comment (tr|A0A0V1Q1V2|A0A0V1Q1V2_9ASCO) Sulfhydryl oxidase {ECO:0000256|RuleBase:RU371123} KW=Complete proteome OX=58627 OS=Debaryomyces fabryi. GN=AC631_01787 OC=Saccharomycetes; Saccharomycetales; Debaryomycetaceae; Debaryomyces.
Sequence
MSSSSSEGSLGKSSPINLSKNNDYYDFKNEQSNLKVPDSSNDEVDNPEVIKRPSKQSKQS
KEEVPDDDIILEATNVQFTETPFMPKMANETLKAQLGNAAWRLFHTILARYPDEPSKQEQ
TTLNQYIHLFAQVYPCGDCARHFQGLLSKYPPQIKSRKTAALWGCHIHNKVNERLEKPEY
DCTTILEDYDCGCGSDEKEDDKTLGNENIEHLRSIKVNEKEESPQLGG
Download sequence
Identical sequences A0A0V1Q1V2
XP_015468520.1.19336

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]