SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V2F498 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V2F498
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily YdhG-like 8.37e-17
Family YdhG-like 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0V2F498
Sequence length 141
Comment (tr|A0A0V2F498|A0A0V2F498_CAUVI) Uncharacterized protein {ECO:0000313|EMBL:KSB87334.1} KW=Complete proteome; Reference proteome OX=155892 OS=Caulobacter vibrioides (Caulobacter crescentus). GN=AS593_03615 OC=Caulobacteraceae; Caulobacter.
Sequence
MKAGATGEPLSGVEAGKLIDERIASLGDWRGQALAKVRALIHEADPDVLEEWKWRGTPVW
SHAGIVCTGETYKAYVKLTFAKGASLPDPSGLFNSSLDGNTRRAIDIHEGAAIDEAALKA
LFRAGVELNLSKKGKQKTPLS
Download sequence
Identical sequences A0A0V2F498
WP_058350658.1.20625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]