SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V8EYA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V8EYA9
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily YdhG-like 1.44e-21
Family YdhG-like 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V8EYA9
Sequence length 107
Comment (tr|A0A0V8EYA9|A0A0V8EYA9_LACLL) Uncharacterized protein {ECO:0000313|EMBL:KST89808.1} KW=Complete proteome OX=1360 OS=Lactococcus lactis subsp. lactis (Streptococcus lactis). GN=LKF67_1499 OC=Lactococcus.
Sequence
MEFEDYFKNDELMNTVRETVKLVFPEAQERISYGMPAWFKDKNVLIYASPQKKHLGIYPK
PNFIENNSASLKEQYECSKGTIKVPYDVETNELKRLVSEIVKWNLGH
Download sequence
Identical sequences A0A0V8EYA9 A0A2A9HTM1 G6FAF3 U5PRA1
gi|385831487|ref|YP_005869300.1| gi|554464521|ref|YP_008703674.1| WP_004254812.1.15333 WP_004254812.1.15553 WP_004254812.1.32081 WP_004254812.1.35288 WP_004254812.1.40656 WP_004254812.1.47514 WP_004254812.1.51877 WP_004254812.1.52093 WP_004254812.1.62525 WP_004254812.1.6264 WP_004254812.1.6372 WP_004254812.1.77362 WP_004254812.1.8561 WP_004254812.1.89978 WP_004254812.1.95624 WP_004254812.1.96756 WP_004254812.1.96923 WP_004254812.1.97467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]