SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V8JCP7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V8JCP7
Domain Number 1 Region: 56-101
Classification Level Classification E-value
Superfamily BAS1536-like 0.0000000196
Family BAS1536-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V8JCP7
Sequence length 109
Comment (tr|A0A0V8JCP7|A0A0V8JCP7_9BACI) Uncharacterized protein {ECO:0000313|EMBL:KSU84400.1} KW=Complete proteome; Reference proteome OX=1017270 OS=Fictibacillus enclensis. GN=AS030_02260 OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Fictibacillus.
Sequence
MVEKLPVKSPSKEGVFRSIFSTWKCRILLLMEYILIYHGGRNDYLGVKDMSPVLNQELIE
LIEHKRDEMIHSARETGFQSVETITRGNELNELLNCYQKLLSIPTHNKM
Download sequence
Identical sequences A0A0V8JCP7
WP_061967912.1.42070 WP_061967912.1.76302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]