SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V8QDN1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V8QDN1
Domain Number 1 Region: 3-138
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 5.1e-27
Family Thiamin pyrophosphokinase, catalytic domain 0.0051
Further Details:      
 
Domain Number 2 Region: 152-221
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.000000000484
Family Thiamin pyrophosphokinase, substrate-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0V8QDN1
Sequence length 225
Comment (tr|A0A0V8QDN1|A0A0V8QDN1_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:KSV58693.1} KW=Complete proteome; Reference proteome OX=290052 OS=Acetivibrio ethanolgignens. GN=ASU35_02510 OC=Acetivibrio.
Sequence
MKNRCLIVTGGTLREEFLTDFLREHVFEKVICVDGALALAEKLDLSFDYLVGDFDSVDKK
VLDGFLERRKKEQPSVEIRQFQAEKDDTDTDIAINLALSKGADEITLLGATGTRIDHLLG
NLHILLKPLKAGVPAFIYDEYNKIYFIEKETRFCKRELYGPYISFIPFGGDVLGVTQTGF
KYETHEIDFCMGESLGISNELVAEEGNISFKQGRFIVIEARDTRV
Download sequence
Identical sequences A0A0V8QDN1
WP_058353128.1.14827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]