SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0V9UH14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0V9UH14
Domain Number 1 Region: 83-143
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000275
Family NfeD domain-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0V9UH14
Sequence length 146
Comment (tr|A0A0V9UH14|A0A0V9UH14_9NOCA) Membrane protein {ECO:0000313|EMBL:KSZ57265.1} KW=Complete proteome OX=1441730 OS=Rhodococcus pyridinivorans KG-16. GN=Z045_19360 OC=Rhodococcus.
Sequence
MVIVAALIWLIAGVALAAGEALTGDFALLMLGGAALVTGGVSAVTDLPVWIDAVIFAVTS
LVLLLGVRPMLRRRYSQPPALPTGIDALPGKHALVLEQVGEHSGRVKIDGEVWTARPLDA
TEVYEPGTTVTVMQIDGATAVVWRGV
Download sequence
Identical sequences A0A0V9UH14 A0A225TMS5
WP_060653287.1.6845 WP_060653287.1.86109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]