SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0F932 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0F932
Domain Number 1 Region: 222-302
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000017
Family Pseudo ankyrin repeat 0.043
Further Details:      
 
Weak hits

Sequence:  A0A0W0F932
Domain Number - Region: 154-203,248-357
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000261
Family Ankyrin repeat 0.018
Further Details:      
 
Domain Number - Region: 15-49
Classification Level Classification E-value
Superfamily SAP domain 0.0192
Family SAP domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0F932
Sequence length 410
Comment (tr|A0A0W0F932|A0A0W0F932_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KTB32847.1} KW=Complete proteome; Reference proteome OX=221103 OS=Moniliophthora roreri. GN=WG66_14650 OC=Moniliophthora.
Sequence
MADGASPLESVKKAYQKFSRSELLLFLKVRNLPTSGSDCELASRLANHDLHTYHFPNGPH
ISLCPSTDLALVTQKQKTRQTQTQDLPIEIIAVILDHLGDWELTRAIGVPTALPRPLEWS
RASPVDLAMISGDVSLIRAADLLSNPPTKIGAEIAIRFGYVNVLEFFLSHHHDIFLSVFQ
GDLIPIRASRHGRTAILSWWKHGFEQHPDLIPKPKPGSIADAIDSASRAGQIASLDWWVN
CGHPLEYTEAALEYASAKNQIAVLEWWKQTSKATSLPLKIGRVMDMASTAGHVEVLEWWA
TSQLEFKYDRHALQHASCHGKVDVLQWWLGSGLQLIFDQDALTGATRHNRAEVLEWWDKS
GLPIQYRMCDIEEALEDAIGGGEATRRWWKLKGVDFNANDKEWMKLQYLN
Download sequence
Identical sequences A0A0W0F932 V2XVR3
XP_007843803.1.35326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]