SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0FG56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0FG56
Domain Number 1 Region: 5-45
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000000144
Family AN1-like Zinc finger 0.0033
Further Details:      
 
Domain Number 2 Region: 56-114
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.00000602
Family AN1-like Zinc finger 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0FG56
Sequence length 250
Comment (tr|A0A0W0FG56|A0A0W0FG56_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:KTB35172.1} KW=Complete proteome; Reference proteome OX=221103 OS=Moniliophthora roreri. GN=WG66_12270 OC=Moniliophthora.
Sequence
MSELLEVGNHCAVCPQIDFLPIRCHCNKFFCKDHIAPDAHTCSALGGSERSNFDNKLHRC
HFENCQKLSLNLSGSDASSASCPQCTNCFCVEHPVAHNCSVNVTEKPRNEAARALLSKHF
SAKASAKAAATATNAKPKSAAQQKLEMMKMRQRAVPLDPKDRFSSLSVAQRRFVKAKIES
GAEEKIIWTQKDVTTGRVFDMLASHLCLPSSQWSRYRLCKVLEDEPLPLQNDKIFADEVD
DGTLVVFVAS
Download sequence
Identical sequences A0A0W0FG56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]