SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0HUS2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0HUS2
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily MbtH-like 8.37e-30
Family MbtH-like 0.0000205
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0HUS2
Sequence length 74
Comment (tr|A0A0W0HUS2|A0A0W0HUS2_PSEFL) Antibiotic synthesis protein MbtH {ECO:0000313|EMBL:KTB64210.1} KW=Complete proteome OX=1198309 OS=Pseudomonas fluorescens ICMP 11288. GN=AO063_18520 OC=Pseudomonadaceae; Pseudomonas.
Sequence
MTSVFDRDDILFQVVVNHEEQYSIWPDYKVVPEGWRTVGKSGMKKECLAYIEEVWTDMRP
LSLRQKMDGAALAS
Download sequence
Identical sequences A0A0W0HUS2
WP_058420603.1.82007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]