SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0SAW0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0SAW0
Domain Number 1 Region: 595-608,650-708
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000484
Family Pseudo ankyrin repeat 0.025
Further Details:      
 
Domain Number 2 Region: 611-899
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000077
Family Ankyrin repeat 0.0073
Further Details:      
 
Domain Number 3 Region: 841-1018
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000547
Family Ankyrin repeat 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0SAW0
Sequence length 1133
Comment (tr|A0A0W0SAW0|A0A0W0SAW0_9GAMM) Ankyrin repeats (3 copies) {ECO:0000313|EMBL:KTC80611.1} KW=Complete proteome OX=28084 OS=Legionella cherrii. GN=Lche_2631 OC=Legionellaceae; Legionella.
Sequence
MIINELFNWLHAHEESLHLSDNYLSRDLLESEQIQAKTTHRRLLAEVRIAKLNKQKTDEL
IDKLEQHQVFMDYLEFCSQKFVEDSASSLFLITFKYVLSKSQPGIPYLGARWNELFFALL
KTDKNKLLSFYQGNEELFKNHPEIQKRVVLELHEQKHKEAIKRVENHLMRLTGQLANQKN
PLGIIGLCREWISEPELFAALILWLLQRNVTTKQILQTYLFHDFLKYHLFTLYSEDNEIF
HLFALLNDFPETKLLLEAAKQTRSDEPAFQHYALDGTLSKNELQDIPRTEYPLQFSLKPT
NFLALHKLFGQQFLIAAITSEEQKNSKWLNTLNHTLNQPQVIAQELPTIITIVAREYSPQ
ILEHLAHLIGDDTAQQLLSNNEGAVFYLLPYKPKLLEHINEENVTRFIQQITVGNTSDPE
IIFQLMALFSMLSKEKNPVTQRVFEAILDNLVLHPMLLEDEKLLCRLRKYPDCGRIIDQK
SEAIKQHVNTCIIAQTRESTFSSRNYHLIEDTWLNATRKLTVLDLIKPQAKFELNNKYAL
QAKIAQAAFLCHGQHFDLNAFIDALSLPPVVADEVSEYERVLIEILAVIDDEFIRNQILK
HLEDEPIQRLNWAEKEYEGKTIFIKAAQHGNLGLIALLEDQIASNALSKAIRTAARANQW
RVVDHLCRNNKTQLSSAELERIIFLAAEQGQSKVIKYLLNTYDYEPSSTELMHILNAAMT
YDQLGVIQLFYYSADNMPKQSGINKLFQAAIELGHWDIALFIAQSENNPPSLVAIEKAFT
HTANTMQLEAMTKLCLLSTNAPRAQTIQRVFVKACQDGNLPVVQSLCKFPKQLPPAIVGE
ALAQASIYGHMGIISHLCNLSTNPPNQSSINHGLVAAAKAGKREPVQFFCSMTTPNQPTQ
HGVNQALLETIKNNQVEIFIELCRSPQHAPSNLAIRESFLLAVKMGKLDSVGCICTYEMS
ALNQRTVEKALILAVKHKKPEIVRYLCELSINSPENKSLKMAVNKAAASNQSAVAEYLRE
QLRSKTKTQKKIDHELDNSSGTHSDSEFSHFSELDNDSETDREITSNPEEDNNNVENHHR
LTVDHRVEIEGRTEENQNTERGASLKSHGLFKTKKQHHRDTPSLDLVGRHSLC
Download sequence
Identical sequences A0A0W0SAW0
WP_058388054.1.28108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]