SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0SFQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0SFQ8
Domain Number 1 Region: 101-116,146-235
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000122
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W0SFQ8
Sequence length 333
Comment (tr|A0A0W0SFQ8|A0A0W0SFQ8_9GAMM) Ankyrin repeats (3 copies) {ECO:0000313|EMBL:KTC82178.1} KW=Complete proteome OX=28084 OS=Legionella cherrii. GN=Lche_0442 OC=Legionellaceae; Legionella.
Sequence
MAISNDPNERLTYCVSKGLVKTVKSLINDINQIQKIQPKTIDMAIESALMTATPKEAEPG
ERINKQWEIITLLCNIPKGLPQPNAKLVKKALAEHEKYYQHLCDTEFTKLIKEKREQMKK
EDWDSVFDYLESDRVKKPSQIAISFTLRVAAYHNDWPVFMKLLNHHEPDWKMAGNLLFSA
VQVGQYDAVKQLCNLSQENMPNTSNIKRAMKEAKRTGHHEIASYLACELIHQNNLEKDPL
ALTQAILQDYVDHSFIGSSLFNSQLKGVKNILTHVKRITAQEHDENARTNAVLDVVQSLQ
HVLGDNKELMGRVDFIKAHRGKIEEAPSLKVEL
Download sequence
Identical sequences A0A0W0SFQ8
WP_058387321.1.28108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]