SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0SW86 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0SW86
Domain Number 1 Region: 91-202,602-655
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000006
Family Ankyrin repeat 0.0044
Further Details:      
 
Domain Number 2 Region: 443-513
Classification Level Classification E-value
Superfamily F-box domain 0.00000000213
Family F-box domain 0.0089
Further Details:      
 
Domain Number 3 Region: 528-731
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000398
Family Ankyrin repeat 0.0083
Further Details:      
 
Domain Number 4 Region: 363-444,555-572,692-758
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000262
Family Pseudo ankyrin repeat 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0SW86
Sequence length 1170
Comment (tr|A0A0W0SW86|A0A0W0SW86_9GAMM) Ankyrin repeats (3 copies) {ECO:0000313|EMBL:KTC87572.1} KW=Complete proteome OX=1212489 OS=Legionella drozanskii LLAP-1. GN=Ldro_1191 OC=Legionellaceae; Legionella.
Sequence
MKEKSTENFSDQKNHSSNDIAINPAVDESFLNTPFAALPNSALADQSSTQADVELNELQR
LRLVPPTIQELEANDFALIKAAAKKQKILDFYYSIAIEDCSRIPWFHWAALCNQIETIKV
HLNEGGNSLCIDLQNRTPAMLAVEIGHLELFEVLLYDKNYNFSQRDIKGNTLANYMVKNN
RLDCIESLLSYIDFHHQQRINPQKSTEEQLYYKNLAGEAAYTFIKVLYLASYDDKNLELF
KILLSMYRNMLQKETGKAPDEAAAKIAFSHIVNKLAYRAAYYNQLAILDYLIEEQLINTP
PEFERSNSSVFSQFLQQLKLRHVIDNFKSLEKEFEPAVKRVLPPAYWQDFINRLDYLRQL
INDTLEDESLKMPILSYLDQSEAHANQLIVLNNDQSDYDKYKNYLRSALDKLWQAGYQLE
ITLDIQEGRRPRQINNYTLKQVPSLPTEVWLSILALTDSTSLVNIQKVDHMLDQVSQDDY
IWKNLFINFFPEEQPDEAADGISWKETFKTHYLEQYGSANRRTKKLISLIIRGDLDALKS
CEISSRDLLVDNFLLLKTAARANNQTALDYFYSLVFTETMRSREDLGALTPEIRNQQEVF
LFFWAALCNQRETIRLNLEHTPTAIDWSEHQGRTITMLAAEIGHVRLFQDLLRRPNSSKN
RLLAPYVAKNGSRDLFLTLVSPDYEHGDIDQASGFDWNKSSRRFRIIVPEVLRHAAQYGQ
INLIRFMLESQAVDFKSALNATIEADNVPLLRKLRALTIEKGDEVYKNILSDRIKVVFGG
YNRDSTLWDSNLCVEFLLKDPLVDISANEFRLFVGNQKTSSVQKIFERPGAPVRDLANLL
DPHTKLPIVYLLPRNSEMQKLLLPHVDLQEILYEMIIQKASLMHIRNIIHFNDHVLKRPP
IKKQVFFNFAEMQDRKRITDVLKIEIDLEKKLETAEISSEQKSFEVLKQQVIATGLSKGL
RYGNNHTQQPAKIKFPQDLLGLSAFQNLLLTDPAQSASLENRYEEAYKEGVSKAQKAKIE
KETKKRKPLPDAEDEKPRKKSKEKLEKAEAEKPASGKRKSRSHSKPEKETNKRQKQERSE
KKASPEQNELLVAEDNTMVMPVSIPTDNAPTSEEKTKKLNSRSSDYSWRLRLFGSPKTES
QPSPTDSKMNEEIDVLEKGNKEEKDELSFS
Download sequence
Identical sequences A0A0W0SW86
WP_058495497.1.7058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]