SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0T6H1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0T6H1
Domain Number 1 Region: 716-736,791-984
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000429
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 617-700
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000119
Family Pseudo ankyrin repeat 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W0T6H1
Sequence length 1121
Comment (tr|A0A0W0T6H1|A0A0W0T6H1_9GAMM) Ankyrin repeats (3 copies) {ECO:0000313|EMBL:KTC91136.1} KW=Complete proteome OX=1094715 OS=Fluoribacter dumoffii NY 23. GN=Ldum_2204 OC=Legionellaceae; Fluoribacter.
Sequence
MLISELFKWLQDEKAALHLSNQTLSPGLCETELSQAQKTNRRLLADIRVARSSNRDTHDL
ITNLKQHNVFMDYLEFCRKKFEENSKCSLFLITLNYLLSQDNSLYPTKLNALFFALLQED
KETILSFYQANQGLFKDHPEIIKRVTAEQNKQKYEEAIKRVELHLARLSDKFATQKHPLG
ITGLCREWVGDTELFAALILWLVQRQVSTNDILSTYLLHDYLKYYLFTLHSEDNEVSRLY
ALLSHFPEASELVQAAQKTCSDEQAFQQYALDGTLAGEELTEISKKHYPVQFSLTSTNFL
ALHELFGQNFLIAAIASEQKNSTWLGMLIKTLNQPRIIADELPGIINCVAREYSPRTLGH
LAQLIDDETAQQLFRNNNGAVFYLLPYKPKLITHINEENVADFIQNLTQGTTSSEIIFQL
MALFSIIAKKKNPSAQLVFETILDNLHHHPALLEDEDFVRQLKKYPDCQKIIDRKCKEIR
EQVKACIIAQTTEPVFTAANYYLIEDTWFEAIQKLNLLHLIIPQAKFDLHNKYALRAKTA
EVAFLFHGELFDLNAFIEALSLPSVVAREVSEYERVLIEILALIDNEPIRRQIIEKLVND
PVHRTNWAEKEYEGKTVFIKAAQHGNLGLITLLEEKIAPEAFNKAIKTAAKANQWDVVNH
LCRNDNALLDEDELEKIIFMAAEKGQLKVTRYLLTAYHYKPSSIELMHILNAVITNNKLK
TFQLFYNSFEKVLNKSDVNKLFNLAIELGHWNIVLLMAHSEKQMLSPAAIDKAFNEAANS
SKLQVIKELCNLPLIAPRPQTIHRAFIKACQKGNLALVQCLHELPEQLLSVTLEEGLEEA
VLNENLAVINYLCSLSANPLHQSSITQALFTAAKTGKVLILDFLCSLNTPNQPMQRAMNQ
ALLWTVKKNQVASFLTLCHAKQNAPNKLAIREAFLLAVKMGIPDIVEYVCENEIHSLNQR
TVEEALKLAVKNKNPGIVRYLCDLATYTPEKKFLRVIYSKALSSGQTEVAQLLNERISKA
SSKKQSTAATNYSSEIDYNSEEENFSETEFILSSTKTGNPGAEEIAPFLTCGSSKDIEDN
GELKQNSETSNLLKGQGFFRTKTQQNSASAPVQIVKGLLSS
Download sequence
Identical sequences A0A0W0T6H1
WP_019350236.1.38032 WP_019350236.1.63490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]