SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0VYV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0VYV0
Domain Number 1 Region: 244-337
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000471
Family Pseudo ankyrin repeat 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0VYV0
Sequence length 776
Comment (tr|A0A0W0VYV0|A0A0W0VYV0_9GAMM) Ankyrin repeat protein {ECO:0000313|EMBL:KTD25086.1} KW=Complete proteome OX=466 OS=Legionella maceachernii. GN=Lmac_2064 OC=Legionellaceae; Tatlockia.
Sequence
MLYLFGSMKEKHPEAQKIPEWTSMFVFDSFLTDEEEKIMDARMKGAFSDVIYPLLPEEDP
LKSLLYVAYAHPEITDEELISGARKMHIPERQIAKAGMILGRPHLYRTAVLEQEQLCGII
KENDFLVMFLATLSSNRPLLDDLAGFLNTERIWEMIKADDYRILFWNNSDARQAILDHLF
NLFSSFDLFNRIAADNYKLLLLASAKDRDLRILNRLFSTPKSQPTQEIVNVLAINQYQLF
AVAAINSNTIIFFYLLSLLPTTEIFQMIVADDFQIFRRAAEKGHLDIIRLFMNQVDSEIR
RKMFASDNFSAFRSAVRKANFELFELALEAVDEPAQKDSMLQHGLQEGFSETFVVGNYFR
MMERLVRTAPQHINLLRIDSLPWWNSNNESLQFLHYLIGLLSNQLPEFLATRKETKQLVN
LQIPLPDTDCLYQVKYNEYPERVLTISYGGGLVPVNHELNVNTLNRTFSINNSLVNPISY
ESRETLPLCFMQSSIPLYAYDYRQSSLQAVSNLHVFNRDIIIPLMTGHPVTSHLELANRE
LQEECQPLTGGIPLKVGNHPIYKTKNKPNFRWLSELYDKFWQYNKDKITYQYAITPSRCH
VRAHFVSTLLRFYGVDSVKVLKFWDKKSCSVYGDEEDWGFHCAVMIIDSNNDKWIWDPWV
GANSKLLSLSQWIDDKNAPVPSEVWVHNRGVLTCSILDRSTGLIPNLAFDCTLGTKFRRF
FQALCASAIPNPPEITPGLGKHPSRFFHSSQRSTASSSSNDERQDERQIVLYRGCT
Download sequence
Identical sequences A0A0W0VYV0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]