SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0WMA3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0WMA3
Domain Number 1 Region: 203-497
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000273
Family Ankyrin repeat 0.0093
Further Details:      
 
Domain Number 2 Region: 571-630,702-735
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000589
Family Pseudo ankyrin repeat 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0WMA3
Sequence length 1426
Comment (tr|A0A0W0WMA3|A0A0W0WMA3_9GAMM) Ankyrin repeat protein {ECO:0000313|EMBL:KTD33448.1} KW=Complete proteome OX=39962 OS=Legionella moravica. GN=Lmor_1999 OC=Legionellaceae; Legionella.
Sequence
MPHLKTPAQLATHPIAHRIPWKIWENEFDYQSRTWELKYMNFDFGKFLQQVNKSYNPYKA
MLCMLFGHQETSPEELLPVLLNVKKKYLELMLKALLVAGRTDILERYIKHPDVNIHPRVL
QHFWTQGCVTAARYDNHSFMQFMAQCLTPEQWWITIESNDFAVYIEAAANGHTAFLHYLE
EHVRPINRHAAALAQSCRAFKEALSNGHIETIRHLNSLMPQAYRSVALTADDFGALLKAA
ANGHTSALEYAEQWMTEEQIMSMVQTNQFEAYRKAAANGHVGTLRYLERRMRPEDVKIAI
LANDFETYRKAAANGSIDTLQHLESHMTKKQITAAVIADYYQAYRGAALNGHVATMQYLE
PRMPYGRKHAALRANQYELVRAAANRRDVLTLEQLQTGLEDRIWREALSVNDYEAYGQAA
ERGDMATLHYMERCFTAEQINEAMSMSNYEGEGCTPYIRAIRNGHMEMVQHLESQMTSEQ
VFEACQSSDFNPYALADNVNILKHLESHLSKVQIYGILSADSWSVYQEVLSGRKIANTEY
IETYMSIDEIKQKLRADSYNIYHYVIVSGYLSNLRHIELYLDKEEIQEVLRANNYEKLNY
ALYRGHIEILKYFEEHILSHEEISVRIRTNNYTSILSALSTDDIELAEYLKGFVTPKEID
GALRRRRLKLWEDALRYDHREFQDLLEGFMTLDEMKQVLQNMNFIVFKEIATNGHIETLQ
HLFEIMPSDFMEAALRSNHYEAYRNALGMWKTDVLRYLESYMPPEQIHAAILSNNYRTYF
LAMRHPKTAHYVERRLKQLGSPRIPDRVIADMYLDAAAGGETSILRQLERSMTPELLNTI
LQCLCNIDHFEVVFETESFSEFRLTRCAKRHPDTLWHLLNHLTFMDWALLHQAECGDVLP
VFLYERCETWQAEARAFAESNPNAVFTLDEANTAFALRAAIGFARHNNHSSQQFLQFLLG
IPSVVAQAHAAVRDEENALLRAAIRHENHRAIQLLMAIPQVYALAQAHNFYADDISGNVD
LRAIAQDRESSLRALTPLEKRRLSRLQKHYAEKIFGGEDKIDPVRVNQILEALRNYLRKC
YEAKPARIILNNKELILPLSWDAFQRLNLTGEVHASALRAYYTHTVHTALRWILKPNPWM
AVNASFAENNPRKGLGYSSFEGYSKEIVLLWAAAGDATAAPTQGHTLEGRIVHFITELAL
INRAHNWDKKRPAKRLDGTEFMEHYDDLEGDNPSCFSGGLRRIFQSITGHPLMRELGTEL
LDAELRDFARAHFSSRITPQNLQQLRGIGEALVDLKELSDQQIETLRGLDISEQEFNTFI
EKLSEKYNMEWKPCHLAYLKDRIAPREGASYHVTRLWILVDFAQLLESQKPSATATASTS
GFFAATSGAASSVPVSDDRPKRDRPEEDSEEQESDLSQTHKRPRQS
Download sequence
Identical sequences A0A0W0WMA3
WP_028384291.1.47995 WP_028384291.1.57425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]