SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0WP36 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0WP36
Domain Number 1 Region: 41-122,161-181
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000144
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0WP36
Sequence length 304
Comment (tr|A0A0W0WP36|A0A0W0WP36_9GAMM) Ankyrin repeats (3 copies) {ECO:0000313|EMBL:KTD34098.1} KW=Complete proteome; Reference proteome OX=45070 OS=Legionella nautarum. GN=Lnau_2068 OC=Legionellaceae; Legionella.
Sequence
MKELREVSTMNIIPELPEELWSLIXXXXAKTSFSKEKIAKLSENLERAKTKFEHAMASAM
YSAARNGHTDLIKQALEKKFIHVNQSLILNTTLLSSAAEREQHNLMQFLLDNEAEPEPAL
SVVLGQLKFITRGSERENRLEKSAFILLNAIEKRGELKSTDSLTQALHGGKLDILKRLFD
LDQGRLIKIDTIATLLQQARGDCKEFLQEKLAQAQSATVLEASAEEQSFTSKVEAEEPFH
FFESSSAVSQLNAVDQDEECSSNNSSAEAENPFRFFESSGATSQATAADQDEESSKHNGV
FAAK
Download sequence
Identical sequences A0A0W0WP36

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]