SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0WS72 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0WS72
Domain Number 1 Region: 391-434
Classification Level Classification E-value
Superfamily F-box domain 0.000000000017
Family F-box domain 0.0033
Further Details:      
 
Domain Number 2 Region: 114-124,186-299
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000103
Family Pseudo ankyrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W0WS72
Sequence length 454
Comment (tr|A0A0W0WS72|A0A0W0WS72_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:KTD35185.1} KW=Complete proteome; Reference proteome OX=45070 OS=Legionella nautarum. GN=Lnau_1856 OC=Legionellaceae; Legionella.
Sequence
PEILEHFYSICEPEFQARPEPENELELLRWAVLRNRGKPDELTLGTIGLALEGGLSDLSR
ELLASPENPHINFHSFVKLLPSVIRSGQNYMLRACDNFIDDYTKLNSKGEFRTIRKLRRN
EVIELAASNGIIPIFSRFANQLQQGITQKEQELNEANTSFSKEKIAKLSAKLKRAKTKFE
HAMASAMRSAAEHGHIDLIKYALKKQFISINQKCGYTTLLAQATESGQDNLMQFLLDNGA
DPEEGLYLIVNTSCDSTLQNGIFTLLNAIEERGELKNIKLLEKCSIKGRLDLLERLFDLD
QGRLIKPDTIQKLLSEHCPVECRNFLQEKLAQAQSAIALKASAEEQPHDSSSDEAENFFR
AGFQHPAPRVEFAHSHFFAPAAFQATATDQPEELWSLILSFLDPESLINSVELVSKKFHN
LANDNLLWKQLXXXXNEYNPRVTRRALVPHFVIS
Download sequence
Identical sequences A0A0W0WS72

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]