SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0YJV0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0YJV0
Domain Number 1 Region: 205-431
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 8.37e-19
Family Pseudo ankyrin repeat 0.0000643
Further Details:      
 
Domain Number 2 Region: 24-201
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000131
Family Pseudo ankyrin repeat 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W0YJV0
Sequence length 519
Comment (tr|A0A0W0YJV0|A0A0W0YJV0_9GAMM) Ankyrin repeat family protein {ECO:0000313|EMBL:KTD57127.1} KW=Complete proteome OX=28087 OS=Legionella sainthelensi. GN=Lsai_1731 OC=Legionellaceae; Legionella.
Sequence
MPKYLFSEDSPFITKWIHLPRQEQLTQDPQLHVIPWAIWVEVFNYRMVFSYLELFSKEYS
EAIHTLPSVPSLEALLCLFFAHAGCKAKIIDDFGRRAGYGPKIVQALTLMGDIECIKYFF
TRLPAARAQEILAMINADNYFAVRWASEYGYKDILEYLIGLIPASDRVQERLAMIQTKNY
QAFRLAARNGHKEILNYLINFIPEAIRADETLALIRTKNYRVFNSAARYGHQDILEYLVG
LIPQEIRIKETLAMLDANNYGVFRSAALYGGKDILEYLVGLIPEEIRTVQTDLMVKADSY
AAFRLAAMNANNIEAVNYLLHYPDCLAYAELHNIEYNYWVRPFITNKLKALKAEEEAYYQ
KHPHGVFNLEHQDCRLGFYMLRHLIRSNDLSKLRDICFLLSIPGIKILTHQEVTKKQPNE
LFHLVMGKDNLLMAALLLTVPAIRAHAEQNNFCAEMYIEPDLPVWARDAEAFMIDLTPDK
SNRPQQYSGNISILEFFTSISCTETEQEFLMSTPNQSIH
Download sequence
Identical sequences A0A0W0YJV0
WP_027270397.1.26361 WP_027270397.1.98946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]