SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W0ZI67 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W0ZI67
Domain Number 1 Region: 167-376
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 2.75e-19
Family Pseudo ankyrin repeat 0.0000471
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W0ZI67
Sequence length 687
Comment (tr|A0A0W0ZI67|A0A0W0ZI67_9GAMM) Ankyrin repeat family transporter protein {ECO:0000313|EMBL:KTD68775.1} KW=Complete proteome OX=947033 OS=Legionella steelei. GN=Lste_1933 OC=Legionellaceae; Legionella.
Sequence
MRIQTEAQRLAHPQARLIPKSLMNDESVFRNELLDDFIPLMQTQTNAQLFACLRDFVMPQ
EQRKRKCLWLAGVYSHPHLSKEQLVALAKQIGLSPKAHLEVSIMLNRQDNLAYVIDLPGY
AEVIEQQVRAFFGLAAGYGCLGMLTDLASKASPEKLQAMIAADDYWAFMWAAENGHLEVL
RYLESKAPDKVQAIIAAGNFAAFRWAAENGHLEVLRYLASKVSLDKVQEMVAAYEFRAFR
LAVNNNQVDVLQHLLGFTSVFAYAEAHQREYGAIVIPYLEQQILNLRTRKQAFEQAHPNA
VFDVGSDEEGDLLFYYARQLIRRNDPALRDALLLLLELPGVKVRAHRAIRGGVPNELLRL
ALSVGNQMAAELLLAIPAVRQEAEAHNYYRDEQQGALDLGQLARDRESSMTALSQGEQQR
LQGILTRYQPLLTAAGIINCMQDLREELVSRYEAHPATVLVPGETAGQSKALVLPMQWSA
FQDLKLAEPYYSAALKAYYAHKAHSAWRYLLKPNPWMHERASYVYVDEQNPQEKWSTFEE
YQPLIAVLYLAAIDHETAASDGYTLETRLTHFIDELALIGRAHNWDDTRSKLDKQGKPIC
EEYDNLQGDRPSCFSGVKRRLFQAVQGHPLLVXXXSQLMCQGCPRTVSGMSPAIQQPSLR
LFSFVNKLPNTYRDDDEHAAVLMLQYL
Download sequence
Identical sequences A0A0W0ZI67
WP_058510838.1.42302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]