SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W1I988 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W1I988
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily RPA2825-like 3.27e-48
Family RPA2825-like 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W1I988
Sequence length 132
Comment (tr|A0A0W1I988|A0A0W1I988_9SPHN) Uncharacterized protein {ECO:0000313|EMBL:KTE75830.1} KW=Complete proteome OX=1759083 OS=Sphingopyxis sp. A083. GN=ATE59_11875 OC=Sphingomonadaceae; Sphingopyxis.
Sequence
MSIFSKIKDAIFGKKAEAATPAPAAPAAPPEVPAGPAAVAVPTAAISEVDVEAILAAEAA
KVTQPLNWRTSIVDLMKLLDIDSSLANRKELAQELGYTGELNGSAEMNIWLHKAVMRELA
ANGGKVPADLTD
Download sequence
Identical sequences A0A0W1I988
WP_040589350.1.46583 WP_040589350.1.83132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]