SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W1QGU5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W1QGU5
Domain Number 1 Region: 6-185
Classification Level Classification E-value
Superfamily VC0467-like 4.45e-53
Family VC0467-like 0.0000192
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W1QGU5
Sequence length 186
Comment (tr|A0A0W1QGU5|A0A0W1QGU5_9SPHN) UPF0301 protein ATB93_16865 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1592629 OS=Sphingomonas sp. WG. GN=ATB93_16865 OC=Sphingomonadaceae; Sphingomonas.
Sequence
MDSAPSLTGQFLLAMPGIGDPRFERAVIAMCAHDGEGALGIGIGATIEGLSLHDLLEQFE
IDPGDAPDVPVHFGGPVEPRRGFVLHSSDWSGQDTIDVAGRWQLSGTIDVLRAIAEGRGP
SRWLVALGYAGWGEGQLEAELTRHGWFNTPADTALLYDTDVYERWAEGFVGAGIDPRLLT
GSSGTA
Download sequence
Identical sequences A0A0W1QGU5
WP_026008877.1.1567 WP_026008877.1.52089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]