SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W4ZX49 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W4ZX49
Domain Number 1 Region: 76-214
Classification Level Classification E-value
Superfamily ISP domain 7.13e-43
Family Rieske iron-sulfur protein (ISP) 0.00000326
Further Details:      
 
Domain Number 2 Region: 33-89
Classification Level Classification E-value
Superfamily ISP transmembrane anchor 9.81e-16
Family ISP transmembrane anchor 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W4ZX49
Sequence length 216
Comment (tr|A0A0W4ZX49|A0A0W4ZX49_PNEMU) Cytochrome b-c1 complex subunit Rieske, mitochondrial {ECO:0000256|RuleBase:RU004494} KW=Complete proteome; Reference proteome OX=1069680 OS=(Pneumocystis carinii f. sp. muris). GN=PNEG_04250 OC=Pneumocystidomycetes; Pneumocystidaceae; Pneumocystis.
Sequence
MLHRLKISVFSIDSGHILYRNVPRVIASRKYSSTTRIPDFSQYKSGSSTQLNRTFSYFMV
GTFGMVAAAGAQATVTDFLSNMSASADVLAMAKIEVDLSVLPEGKNMIIKWRGKPVFIRH
RTLEEIEEARSVNISSLRDPQTDDERTKKPEWLVMIGVCTHLGCVPIGEAGDYHGWFCPC
HGSHYDISGRIRKGPAPLNLEIPEYNFVDEDKLVIG
Download sequence
Identical sequences A0A0W4ZX49
XP_019613411.1.78607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]