SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8B8S3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8B8S3
Domain Number 1 Region: 203-544
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.97e-37
Family Ankyrin repeat 0.0007
Further Details:      
 
Domain Number 2 Region: 34-216
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000156
Family Ankyrin repeat 0.0031
Further Details:      
 
Weak hits

Sequence:  A0A0W8B8S3
Domain Number - Region: 517-595
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00106
Family Pseudo ankyrin repeat 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W8B8S3
Sequence length 631
Comment (tr|A0A0W8B8S3|A0A0W8B8S3_PHYNI) Uncharacterized protein {ECO:0000313|EMBL:KUF68298.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10012061 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSTLTSARVVCLAHPRIDALSHVPQLVSQYLDVSTRWSLARAAERGFVHLVRRLLTTLNT
SNLNVMAETRAAMRSAAANNYLDILEILSTHYPHAVIDETIIMQAASNGHGEVLCWLQPR
LRKLLPCYKEYDFYSLKSVAAAVENGHLSVVQWLLDARGTQDTGDLTETHLHQATARGGH
LGVVKWLRTHVEEDIESRALDEAAAGGFLDVVEFLHNEWKEAKLESNRCSCRATSRAMNG
AASNGHLEVVKWLHEHRDEGCTMDAMNRAAWNGHLEIVKWLHDHRTEGCTQQAMNMAAKG
GHLAIVQFLHENCTEGCTYNAMDWAAQENHLDIVKWLHVNRSEGCSRLTMNEVAKRGHFE
MLKWLHENRTEGCTVAAMNAAATHGHFDIVQFLHANRSEGCTNTAMDGAAENNHLAIVEW
LHRHRSEGCSRRAMDSAARNGHLEMVKWLHLNRNEGCSTSAMDGAAEYGHLDIVKFLHTN
RTEGCTYRAMDKAAGNGHLEVVRWLHNNRQEGCSSDAMDEAAKNGHMAVMRFLQVHRQEG
CTVRALNAAAARGGFETLEWLRAESSLEIEELPIHAALAAISRDRIEILHWLLTHLVADG
VHELRILYDAARYHNRSHILAYLDGYWTIDM
Download sequence
Identical sequences A0A0W8B8S3 W2R9P0
XP_008891401.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]