SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8C3S2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8C3S2
Domain Number 1 Region: 256-618
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.34e-20
Family Ankyrin repeat 0.0047
Further Details:      
 
Domain Number 2 Region: 109-212,241-284
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000588
Family Ankyrin repeat 0.0087
Further Details:      
 
Domain Number 3 Region: 22-80
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000314
Family Pseudo ankyrin repeat 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W8C3S2
Sequence length 651
Comment (tr|A0A0W8C3S2|A0A0W8C3S2_PHYNI) Uncharacterized protein {ECO:0000313|EMBL:KUF78712.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10010035 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MWSIRKLLRSYKLYGKLQFTLCLLEAVKINSLEIVQWLFERFPDYGVRRPVVYGAAEAGA
LEILQYFREHGTTVNHEDEENLEGGRWNEETENWEKGRWVYWGNEDAAQAALGGHQDAVM
YIYETTAYEDRCDYDTIGGAIIRGDLELAEWLSDRLDMLPDGPDAHLGAAANGHVRSLQW
LHARGQYSMYDXGVLVRAAEAGHLDVVRWIIDRDWNDQGLGTDSGEDEDEYAMGYNRGNR
TRRTHITCLGGEASLAIHAAAIHGHLDVAKYLHSRIDIPLDAIDRVKEDWRLYKRLKAIS
RQIGQNNNAAKVSGVTMLLAAQRGHADVVQWLYEEYHGDPRINLFWVYSDAEAKYVSVVD
AAAANGHLEIVKYLLQVGKEGNDSVGPPQKRQRTQESSNFTVREDMHDTHSELLDDPTMP
SCTKKAIDNAAAAGHLDVVKWLHVNRTDGCTADAMDLAALNGHLEVVQWLDANRNEGCTT
GAMDNAATSGELAVVKWLHEHRTEGCTLXAMNGAASNGFLIVVKWLHDNRSEGCSSAAMN
GAAARGALDAVKWLHHHRSESCTPLAMDEAARKGHLHVLRWLFENRDEGFTTVAVYNAAQ
AGHFETVLILHNLAQKGLVPEVEKMNEDASMVLISDIYQEVVRAVLPKTDE
Download sequence
Identical sequences A0A0W8C3S2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]