SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8CG50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8CG50
Domain Number 1 Region: 195-238
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000523
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W8CG50
Sequence length 316
Comment (tr|A0A0W8CG50|A0A0W8CG50_PHYNI) Mitochondrial inner membrane protease ATP23 {ECO:0000256|RuleBase:RU364057} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10002982 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MEQYECEDAVQTALQQRRPQHIFLAQQHSEGKSTVPAIDFVCLECRDDGPEGNARAFFSA
PPPTVVFCANRLHSAREVEETMVHELIHAYDFTVRKMDITKSDILACSEIRSARESECYQ
KAKLLETVLPNVEFFQKSARWLNARCVREHAVRSTSRTVRFKCFLATPPAETSPLNAMSS
AIPPAANTKDPKVRAELYMASHGIKELFEGLGTLLLYHRPPNPREFLIQQLDEMRKAKNE
QHHVPFFEENDLKVMFAAFDIKDQGFITTEQYDQALLNLGIEKPTLRLPESVSTINQALF
IRSVTQEIKNASTSFM
Download sequence
Identical sequences A0A0W8CG50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]