SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DAK0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DAK0
Domain Number 1 Region: 217-441,473-551
Classification Level Classification E-value
Superfamily Enolase C-terminal domain-like 7.07e-29
Family Enolase 0.00038
Further Details:      
 
Domain Number 2 Region: 71-209
Classification Level Classification E-value
Superfamily Enolase N-terminal domain-like 3.12e-17
Family Enolase N-terminal domain-like 0.0003
Further Details:      
 
Domain Number 3 Region: 24-60
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000243
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DAK0
Sequence length 569
Comment (tr|A0A0W8DAK0|A0A0W8DAK0_PHYNI) Extracellular matrix protein 3 {ECO:0000313|EMBL:KUF93380.1} KW=Complete proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM588_10008153 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MVQQHDRDDQEEDEEEEQMRERDLVEAYVAEHSLETSLNDVINQVVATRPEDPFLMLSSL
LYARATAKRGILFVQVCEALDASGEPTVLVRLHTGKGIFEGCCSAEAGGITDRESDAKTR
DIDDAIASIPSSKLRYGGRGFTKIAATAQELLTEKLVSLEPTDQSTLDAILQDLDTTLGR
NVCAATSLAICQAGAKYAELPLHDYVAKLQELPPENQCVPMPHFSVVNGGKYASNKLFAQ
EVLMIPTSAASFADALQIAVEFNSALRTQLETRGVGFTNRGAFGGFAPQLQTLDEVFHVL
RAALDDVRVRLEDSEAQVISTASASPLRVDFGVDFAASEFVVPPIRTDSDTAQNEDDNET
PRSFTYNTDRWVPGSSGALKNSDEILNTVRSSVKELDITTVIDPFDVGDIKNFAALNNSE
NDSDGSALASGEPQEGGVKENVGLGGDPNCRVQIVGRSVVERHGLTALSEERACNTVLLV
PHQFPTVSRLLQAITDTQRLGLAVILGASAGQPGADAEVLNAVAMGSGVGQVKFGGLLGA
ESQDRYRKLLLESQEPGAPPFVGANAYRR
Download sequence
Identical sequences A0A0W8DAK0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]