SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DID6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DID6
Domain Number 1 Region: 231-449
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.46e-23
Family Ankyrin repeat 0.0041
Further Details:      
 
Domain Number 2 Region: 431-532
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.00000000000111
Family Pseudo ankyrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DID6
Sequence length 592
Comment (tr|A0A0W8DID6|A0A0W8DID6_PHYNI) Serine/threonine-protein kinase {ECO:0000313|EMBL:KUF96095.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10006002 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAPEPLTSVLVVARSQPGIAELSHVTDTLSAFLDHSSSLPLARACAVDSVSLLQRVWDIS
KSRETVMDPWCQPTNTWSPSRMLWTNRFYYQDQFSKGMIEACTHADVRSVQWLIDQFTGC
AVPLEAVEAASQRGKRDILQLLLKVHEQHKKASMPGARNPTDKKPHQVKFWESNALLAAA
TGGHGDLVIWLYTDVFHGFYMQSNQEVMDELARHGDMETVRRLVSDGWQPPRLDYAAEGG
NIAMIQWLLDQNRDVGKQWALKNAASKGHLEIVKLLVDEDMVYLDGEAFCEAATHGHLLI
VQWLKENNLGWNMAYKAIDLAASNGHLEVVQYLHSSCSVTCTHHTMRTAASSGHLPVVEW
LHEQFGNQSSVNLYAAGSKQQFNTTVMDIAAMNGHLQVMKYLHKVALTMEWVTAVDEEIL
EKTVPTCTSAAIQFAAAGGHLDVLNWLHENYWVEPSVDIMDVAATSGNLEMVKWLHDHAA
ARFSPAAMDGAGKEGHLAVVKWLHENSPEGCTAKAIDEAAAMGRLDVVQWLTENRSEGCS
TKALDGAMNGDHFDVALLLTTKYPELGKNSDFEFIDNDHIRAWVEEMYPTYS
Download sequence
Identical sequences A0A0W8DID6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]