SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DMQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DMQ8
Domain Number 1 Region: 183-551
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.44e-21
Family Ankyrin repeat 0.0056
Further Details:      
 
Domain Number 2 Region: 68-136
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000536
Family Pseudo ankyrin repeat 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DMQ8
Sequence length 663
Comment (tr|A0A0W8DMQ8|A0A0W8DMQ8_PHYNI) Uncharacterized protein {ECO:0000313|EMBL:KUF97670.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10009118 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MLSCIEVVLRSHARLKDAEFASWMVSSFLGPPPNMSLREACSTGCIRLLDWIWISSCTSV
ADRVPHWTLTNYLRSDRYYYHYQFTKSLEVAANRGDLEVVKWLVVHFSGCEAPASVVGAA
VIKGHLSVVKYLWVHCRYISAECNKKRKVVDDKGQVLAEKRSEELIKHKAAGNRVCWGDR
IVLLAAEHGHFDMVRWLCENTLGEEEKYYETYDKVMKHALRFGDDDLTKFLLPRGRCILD
YAKKCPRLEVIELLLDCGYLXRDEEAAASAIRGLAAGGHLELMQQIALLHSPLREDYTHW
GFNKLLYSWFMALVDSCKYGQLETVQWLHRYPICQRAIKLVKRRAHITIPMTEAAGEGHW
NVVQYLCEQKTAKDYDEPLERAIRNGHLKCVEIIIRHFLNTRQRPRTCPIDVAAKAGRLE
VVQFFHNFNPQYQFNSELSGSDAWWSQSRDSFCGAAASGNLELVKWLHASGYDNGAKDAM
DAAARAGHFDXVKWLHLNRQEGCSPYAMWSAAMRGQLPMVQWFHFIRAEEWAIQDMDWVA
RRGHLDVIKWLDANKLWRCSDYSAKEIYRNGPLRVASWLYNHYPEQTPVNLNGVLNTRRV
EIFEMLLFLDVHSPQCINRQFAEDTGKFVLEYSLEMADGNCHILSWLKVKLPSMELPNYH
YYP
Download sequence
Identical sequences A0A0W8DMQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]