SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DXL7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DXL7
Domain Number 1 Region: 1521-1592
Classification Level Classification E-value
Superfamily Chaperone J-domain 0.000000000000157
Family Chaperone J-domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1622-1660
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000654
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0034
Further Details:      
 
Domain Number 3 Region: 1671-1744
Classification Level Classification E-value
Superfamily EF-hand 0.0000000967
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DXL7
Sequence length 1746
Comment (tr|A0A0W8DXL7|A0A0W8DXL7_PHYNI) Uncharacterized protein {ECO:0000313|EMBL:KUG00870.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10004999 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MGVISVGASLGVREAPAPPAPASASSTSTRRSSSSTGASSTAPNGRKKSSRKRVAGASGA
KKQRANYSANTTRNERSTALPSAPTAPIPNVREVAPPKPAAASVTPSVSMVINTKKPVGR
MVHVKTTMDPQQLAPHVIGVNGGKLNDIMSRARCSISYRKTQTQEPKEEEAFSMAFMISA
NTTKRVEDGVLLLQAVVESTEQQLKKYAGSMEQIQQVEGDDAVQEVAVHMETGSEHEEKG
QSAEKQQQIRQQAEVMQQVSDGTMTSRDRSRSRSEPREEMAQRHPKRRREVSDASSSASK
RGRSEDLRTVNENQVQRSRRTARNQDEEYKDDRDTDVNDAVARAEEERCLRDEREAYRIR
LARTVMIQRRLEVEAKRARAQELLERDKYLQLRRKYEEMEHRKKVAELVVKKQCSAMTAS
LSTSSPSKKKRCLREIVRLSMAHDACPPATNPVLVPNLRVGVLKAKRQGAGNPRLAGIQL
ISSELAEDDDLMRLVKKVKAFGKMITSGPIDLPVEDSNVENNNYHDENRTDTFDFPSEDA
DISMDVSNDDEAMADASVDIPAGDNAEKSSPRRDSFRSTWDLPGLTRDLNLIQDYTSETD
CKLLRFLAGERQYFYLEPLVNSSAYSHDVERWLLTAHDLQILHRYLLDRADMGKELVLCA
ERLRALGNLVPPLSSSPSEHPLIGDLGVFESSRHKGWSEMQDLIVTLHSLALVAHMLGKH
YVARQVMGSNRGGASHENVLDERTLESDLFTYILRPIRSSAIESSLFDSLPISLVRETIE
QCPEVVNHVLQWKGKDDVPEYLCEVDSCDSDLSATTSGQRMHPSSSYFLRNLLVRLTTHM
KDLDVLMKDLVATLKEKRPELHVDNANHVILRRQRIIAHVNRLKSVTTHVIVENTKLQLH
KWWLLFAENSCAWFDPDDVDELDDRSYDKFTCLQDALYIWHNEALLYSTKDDFVDPERLE
GEEESPFYHTEEDAIDGGYDTRAEGSGSSPYGDVPRDANRTPMAREEEIAALLRLTPASM
RGEVQNGPFTRDEVKKCTMTPLDVENARTQLEESLAVTRDLMNELGHAGPWRTHVNHSNA
LKCELAKQVAIQKKLVKHHWARYYTKHQEFAPPQEETSDPESEDKAPCESVETQPEGEPT
SENGDAVTSMAIDWTGVFDPATDSPDVIEMKKLRHEITLAKDQLLRDISGGGDHESGATL
NTDQKALIEECNGLAASCMQALGKFLGIEETDKTTAKPAQKAMHRPATKPARTDKRAVSN
SKREKTSRTASTSGRRHSHGSKKATSHSKSSPGSRSRRIESIRVAKALAASSAGLLIPAT
RSRTSSSRAMSVRSIGSNRGQRSDDNSPLRMGCSGCRDTRRRCTGCSGCCLHSSLNATLR
GNTAAPPSRRERRFKINPVAAQRRGPNLPTNEGEEAVPASAHGRSNGGLPTFARHAHGRG
PLPTFDYGIEGAFGLGPMDQRGQCRTWRPAPSDKNEQEDLFRAARVRMKLVRSAFTKSTG
LSSGSGCLDGEQLWQPERIRMMWERRDFHGVLGLPRDATTQQIKRQYRKLALKLHPDKAS
DTSASLESTVAEAGKNVGAESSGKRVDAFVAATHSYKILLGDVDAMRGLGDNMDVNRIFS
AEQIAVPPDLPHVLKDWTKAVIRENPTDLLAFSQQWFQDKAAQVSQRKAVENQIRRMRQL
FESYDVDGQGRMEAKDLGKFLGEDLGMDGYEDGSPAELLEDLVMELDPDNTGFVELHDII
QWYQQR
Download sequence
Identical sequences A0A0W8DXL7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]