SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DYZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DYZ1
Domain Number 1 Region: 146-169,254-552
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000186
Family Ankyrin repeat 0.01
Further Details:      
 
Domain Number 2 Region: 86-99,132-224
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000209
Family Pseudo ankyrin repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DYZ1
Sequence length 647
Comment (tr|A0A0W8DYZ1|A0A0W8DYZ1_PHYNI) Fem-1 A-A protein {ECO:0000313|EMBL:KUG01580.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10006829 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MPITTVSLILPRAPDIVTVIISDFLVADLTLSQACEWSPLGSTFLLDLVWMRSLRDAQTS
KWTFAKLLQSERSYYRWAFSQSLVQTVRRGDLXMLQWLLSHFSGCPVSQEVVEEAARGGH
LWALQLLERDTSHAGIEWSDRAVDRAAKIGDWELVRWLLQRTGSTRETRRADDEVVNSAF
EQNNLLQVKWAIGCGFGVGGIQFPDCTEAEWQGRAEILRYLLDGGHVPVANIAGVGAYQA
ARFGDLYFLKWLEYQLKAEIDVQYWTHALENASESGYLAVVQWILTHADGVVRANGPADA
MFAAAENGKLDVVHWLYKHYGSKPKVGLFQERDVPDGTGNDEEHFWDEDLVPTTAMDAAA
KNGHLAVLQFLDSIDTSSRNKQKKRGGKLSHNRQVGRYPRCTSFAMDAAAACGHLHVVKW
LHSHRLEGSTRRFHVSSCDGFGFDVCCLHITPKSFFENQLEMLKWLHLNRSEGSSSAAMD
GAAANGNFEMLQWLLENCTAGCTTESIVSAARLGRLDIVKWLDQHYPNVHTLKAMSEAAS
VGHFNVVKWIYEQHTPGHQTVAESMKEAAAGGHTRLVKWLLPHCTKPSSLLSAMKAALSS
HSFEAMLLLDAQLVNHYTDGDLRNHWFRYQDIRNWFDEKYSPSAEGE
Download sequence
Identical sequences A0A0W8DYZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]