SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DZ68 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DZ68
Domain Number 1 Region: 142-505
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.99e-26
Family Ankyrin repeat 0.0023
Further Details:      
 
Domain Number 2 Region: 588-673
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000719
Family Pseudo ankyrin repeat 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DZ68
Sequence length 772
Comment (tr|A0A0W8DZ68|A0A0W8DZ68_PHYNI) Uncharacterized protein {ECO:0000313|EMBL:KUG01414.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10008858 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSHSPKVVILNIKLQMVLYRSLIYRLRIPDNFLISRALGFPRKHYFPLKSIQFNITLTSK
EIFIPAPAFPVFRMSYXKITRIVVKRCLPANTLHHVMRSIDEYLTSFLCHEVFTAACGEG
ASRCTLEFLLHRIAAPDWKEAVQAAVRGGHVHVLHWMTERSDDRGPWKKDFTDVLAIAAT
QGNIDVVKWLYKRGVDWHTLWDKLEGVDYVKDSFLYTHCASDALELAVEHGHLEVAQWIY
NTSSDSCIRWSKSMERAVANGHLAIAQWLYTVSGKSCSSFSMNLAARNGHLEMLEWLQSK
DLVKCTKTAMEGAAQSGNLDIVKWLQRTRNGNCTVRTLHLAASGGHLKVVEWLYQNFPCY
DYALHASYSAAKGWYLDVLQWLHVRLPSTFSEYDMDGAATNGHLNVIKWLHEHRSEGCTH
MAPFHAARHGHLEVIQWLHAHYPDKFVRQAMDQAAGNGHLHIVRWFHENCREGCTAYAMY
LAARNGHLNVMLYLLEHRSEGFPSNVMTAAHNFEVQCLFSSSRPLSLKTDRSHRVHEPMI
VLQSAYNKRPAFVKDCLRCLAQIATCEGNIEILDWLNQLGLELRTTIPIRDAVARGNVQL
LQWFYSNQFELQDPDLLELAVQKGQLDAARWLSKRGFKITSLNLIEEAGRNDNVSLLRWL
VEHGPPLDFDAALVLTGKYHHEEIVPMVSESVRVLLVREALQSSNRNLVWHILVGTRIED
ENSRETIRDAIQHASSSMLRWIEDSSICESCVWCLPALRKRRASEMGLVDQN
Download sequence
Identical sequences A0A0W8DZ68

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]