SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8DZH0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8DZH0
Domain Number 1 Region: 43-119
Classification Level Classification E-value
Superfamily tRNA-intron endonuclease catalytic domain-like 1.4e-20
Family tRNA-intron endonuclease catalytic domain-like 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0W8DZH0
Sequence length 203
Comment (tr|A0A0W8DZH0|A0A0W8DZH0_PHYNI) tRNA-splicing endonuclease subunit Sen2 {ECO:0000313|EMBL:KUG01427.1} KW=Complete proteome; Reference proteome OX=4790 OS=Phytophthora nicotianae (Buckeye rot agent). GN=AM587_10015554 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
METKRRRHLSLPETYYAVINGLLPIDEPLRELWERFNSLSVAFVRNFIVYQHFRHLDWIP
KSGLNYGAHYVLYRGSATEFHSEYIVYVQDEASSWNTIQSLTRIAADVKKTVLLCTVTAE
ITGSEDSPADLTFGVYSFHDVQYTVEAIAIRFWDPSIADGPQSYTFQQQPVLSKKPKTVK
KKNRAKRPKHQLEETLTTSGNSA
Download sequence
Identical sequences A0A0W8DZH0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]