SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0W8EY12 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0W8EY12
Domain Number 1 Region: 1-123
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 3.53e-25
Family Thiamin pyrophosphokinase, catalytic domain 0.0012
Further Details:      
 
Domain Number 2 Region: 130-196
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, substrate-binding domain 0.00000000497
Family Thiamin pyrophosphokinase, substrate-binding domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0W8EY12
Sequence length 202
Comment (tr|A0A0W8EY12|A0A0W8EY12_ELIMR) Thiamine pyrophosphokinase {ECO:0000313|EMBL:KUG13374.1} KW=Complete proteome OX=172045 OS=Elizabethkingia miricola (Chryseobacterium miricola). GN=AMC91_02945 OC=Flavobacteriaceae; Elizabethkingia.
Sequence
MKALLFINGEPPKNIPEIKDYDLIACTDGAFHYLREKNFPLDQLDFISGDFDSYDDEGIL
SEKLIHTPDQNKTDFHKALEIIIEKGFYEVDVYGGSGGEQDHYLGNLTVAYLFRNKMEIT
FYDEYSKYFFISNEFEVQNVLGKIVSLVPYPVAENVVTKGLNWPLFGEELSMTGRIGTRN
FAVEDTFTCSYSDGAILLFIGK
Download sequence
Identical sequences A0A0W8EY12
WP_059154319.1.48915 WP_059154319.1.49306

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]