SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X1KKK1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X1KKK1
Domain Number 1 Region: 97-183
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 3.3e-29
Family TATA-box binding protein (TBP), C-terminal domain 0.00000687
Further Details:      
 
Domain Number 2 Region: 4-89
Classification Level Classification E-value
Superfamily TATA-box binding protein-like 1.57e-27
Family TATA-box binding protein (TBP), C-terminal domain 0.0000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0X1KKK1
Sequence length 191
Comment (tr|A0A0X1KKK1|A0A0X1KKK1_9EURY) TATA-box factor {ECO:0000256|HAMAP-Rule:MF_00408} KW=Complete proteome OX=1432656 OS=Thermococcus guaymasensis DSM 11113. GN=X802_06180 OC=Thermococcus.
Sequence
MVDISNVKLRIENIVASVDLFAELNLEKVIEICPNSKYNPEEFPGIICRFDDPKVALLIF
SSGKLVVTGAKSVEDIERAVKKLTQMLKTKVGTKFTKPPQIDIQNMVFSGDIGMEFNLDV
VALSLPNCEYEPEQFPGIIYRAKEPKAVILLFSSGKIVCSGAKSEKDAWEAVKKLLHELE
KYGLIEEEEEW
Download sequence
Identical sequences A0A0X1KKK1
WP_062371862.1.54898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]