SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X3QGV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X3QGV7
Domain Number 1 Region: 231-351
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-34
Family cAMP-binding domain 0.00000219
Further Details:      
 
Domain Number 2 Region: 361-482
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.9e-33
Family cAMP-binding domain 0.00000295
Further Details:      
 
Domain Number 3 Region: 8-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000000000405
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A0X3QGV7
Sequence length 494
Comment (tr|A0A0X3QGV7|A0A0X3QGV7_SCHSO) cAMP-dependent protein kinase regulatory subunit {ECO:0000313|EMBL:JAP58976.1} OX=70667 OS=Schistocephalus solidus (Tapeworm). GN=TR113756 OC=Diphyllobothriidea; Diphyllobothriidae; Schistocephalus.
Sequence
MDDESYVQDLEDYIKKHNIPNLLKECIVNLCLYRPSDPVHFLHEHFRILDVAPASSSNRK
SSPPRLDEQHSLPRASSSSSSTAAAAASACFRPALSRFSNGDAYLPAAPELLTSSLTTHP
TDTLPKDAHSESTSATSVTLMDEGLFFPVEAASLKSYGDGAADELSPETTQNGELFIDDG
SSNDACLSFSPAPTVSGGGCSIPVKRRVRRGAVSGEVYTEEDAASYIKKVVPKDYKTMTA
LSKAIARNVLFAHLDENERSDIFDAMFPLHRNPGDTIIQQGDEGDNFYIIDQGEVEIYVN
GEYVSCIGEGGSFGELALIYGTPRAATVKAHTEVKLWGIDRDSYRRILMGSTIRRRKMYQ
DFLSRVPILDNLEKWERLTVADALEPVRFETGDCIVQQGDPGDDFYIIIEGTAAVLQRPA
ENAEPVEVGRLGPSDYFGEIALLLDRPRAATVVAQGPLRCVKLDRKRFERVMGPCSDILK
RNIAKYNSYISLSV
Download sequence
Identical sequences A0A0X3QGV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]