SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X3SD30 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0X3SD30
Domain Number - Region: 43-93
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00183
Family Streptomyces metalloproteinase inhibitor, SMPI 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X3SD30
Sequence length 134
Comment (tr|A0A0X3SD30|A0A0X3SD30_STRRM) Uncharacterized protein {ECO:0000313|EMBL:KUJ39831.1} KW=Complete proteome OX=132474 OS=Streptomyces rimosus subsp. rimosus. GN=ADK46_11880 OC=Streptomyces.
Sequence
MRTVHTGLLIAGAAALAAAHLGVPPAHGTPQPRPRAHTGPAAGDCATGQFCLWPGRGFSG
ERQVHELADTDIESCVTLPAGARAASFANRTGRPVTTYQSAECQETGEFDTYPGGGSWVP
ESPYQVRAFKIWES
Download sequence
Identical sequences A0A0L8P7U9 A0A0X3SD30 L8F275
WP_003979720.1.100537 WP_003979720.1.10659 WP_003979720.1.11843 WP_003979720.1.16484 WP_003979720.1.16806 WP_003979720.1.16854 WP_003979720.1.19068 WP_003979720.1.21275 WP_003979720.1.23387 WP_003979720.1.27584 WP_003979720.1.27877 WP_003979720.1.29142 WP_003979720.1.29667 WP_003979720.1.40819 WP_003979720.1.41790 WP_003979720.1.44064 WP_003979720.1.46139 WP_003979720.1.47700 WP_003979720.1.55007 WP_003979720.1.64888 WP_003979720.1.65676 WP_003979720.1.69365 WP_003979720.1.72292 WP_003979720.1.75076 WP_003979720.1.7965 WP_003979720.1.83370 WP_003979720.1.86519 WP_003979720.1.86803 WP_003979720.1.87188 WP_003979720.1.91872 WP_003979720.1.92884 WP_003979720.1.9496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]