SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X3TCE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X3TCE7
Domain Number 1 Region: 5-187
Classification Level Classification E-value
Superfamily VC0467-like 4.45e-55
Family VC0467-like 0.00000501
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X3TCE7
Sequence length 188
Comment (tr|A0A0X3TCE7|A0A0X3TCE7_9GAMM) UPF0301 protein AVO41_03240 {ECO:0000256|HAMAP-Rule:MF_00758} KW=Complete proteome; Reference proteome OX=1685380 OS=Thiomicrospira sp. WB1. GN=AVO41_03240 OC=Piscirickettsiaceae; Thiomicrospira.
Sequence
MQTLQSLEHHFLIAMPNLANSWFDKALIYIVEDNEYGTMGLVVNYPHQLDVSQLLEHFDL
PIPPEADYLHDVVMMGGPVDMEHGFILHQPEGDWEKSLPLPDNLGMTVSEDFLKALSEQQ
APDAFLVCLGFAGWEKGQLNDEIQANNWLTIPYNASLLFDVPAEKKWETAIHTLGISPEF
LSMDAGHD
Download sequence
Identical sequences A0A0X3TCE7
WP_068582465.1.30236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]