SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X8JYL2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A0X8JYL2
Domain Number - Region: 23-52
Classification Level Classification E-value
Superfamily Delta-sleep-inducing peptide immunoreactive peptide 0.00719
Family Delta-sleep-inducing peptide immunoreactive peptide 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0X8JYL2
Sequence length 105
Comment (tr|A0A0X8JYL2|A0A0X8JYL2_9STRE) Initiation-control protein YabA {ECO:0000256|HAMAP-Rule:MF_01159, ECO:0000256|SAAS:SAAS00370317} KW=Complete proteome OX=712633 OS=Streptococcus sp. oral taxon 431. GN=AXE83_06630 OC=Streptococcus.
Sequence
MNKKELFDALDDFSQQLLVTLADVEAIKKNLKSLVEENTALRLENDKLRERLGEVEETAP
AKTKHVRENVRRIYEDGFHVCRDFYGQRREQDAECMFCDELLFRE
Download sequence
Identical sequences A0A0F3HB94 A0A0X8JYL2 A0A1E8TYL2 A0A1E9A5A7 A0A1E9AWY4 A0A1E9ZXY3 I2J1U4
WP_001034369.1.13813 WP_001034369.1.19177 WP_001034369.1.22339 WP_001034369.1.28041 WP_001034369.1.38606 WP_001034369.1.50767 WP_001034369.1.55339 WP_001034369.1.59231 WP_001034369.1.68794 WP_001034369.1.69287 WP_001034369.1.76160 WP_001034369.1.99231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]