SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X8Q7R7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X8Q7R7
Domain Number 1 Region: 10-212
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 6.8e-67
Family Chemotaxis phosphatase CheZ 0.0000000509
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A0X8Q7R7
Sequence length 213
Comment (tr|A0A0X8Q7R7|A0A0X8Q7R7_ENTAG) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome OX=549 OS=Enterobacter agglomerans (Erwinia herbicola) (Pantoea agglomerans). GN=AL522_15565 OC=Erwiniaceae; Pantoea; Pantoea agglomerans group.
Sequence
MSDFPKPTEDAAAHDIISRIGSLTRMLRDSLRELGLDKAIADAAEAIPDARDRLDYVVQM
TAQAADRALNCVEAAQPHQDKMEAGATQLKGRWDAWFENPIELGDARELVTDTREFLTAV
PEHTAFTNKQLLEIMMAQDFQDLTGQVIKRMMDVIQEIERQLLMVLLENMPEVSAEKRQE
GTSLLNGPQIHADAPGVVANQDQVDDLLDSLGF
Download sequence
Identical sequences A0A0X8Q7R7 E1SGL8
WP_013358224.1.41229 WP_013358224.1.72025 WP_013358224.1.78215 WP_013358224.1.84457 gi|308187225|ref|YP_003931356.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]