SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A0X8UX73 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A0X8UX73
Domain Number 1 Region: 3-135
Classification Level Classification E-value
Superfamily MTH1598-like 1.44e-36
Family MTH1598-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A0X8UX73
Sequence length 135
Comment (tr|A0A0X8UX73|A0A0X8UX73_9EURY) Archease {ECO:0000313|EMBL:AMH93864.1} KW=Complete proteome; Reference proteome OX=1495144 OS=methanogenic archaeon ISO4-H5. GN=AR505_0142 OC=Archaea; Euryarchaeota; Thermoplasmata; unclassified Thermoplasmata.
Sequence
MERYEVLDHTADLMIKGYGSTLEECYANLAYGMFDQTVDLRDVTPTETREVNVTGFDDED
ALYSFLSELLFIEAYENIILKEFEVKIDGLHITCTARGEPLDRSKMRIRGEIKAVTFHMM
DIDRETPSVTVLFDV
Download sequence
Identical sequences A0A0X8UX73
WP_066073406.1.32393

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]