SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A100HZF3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A100HZF3
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily LigT-like 0.0000000000497
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A100HZF3
Sequence length 169
Comment (tr|A0A100HZF3|A0A100HZF3_9MYCO) Uncharacterized protein {ECO:0000313|EMBL:GAQ31929.1} KW=Complete proteome OX=1136880 OS=Mycobacterium pseudoshottsii JCM 15466. GN=MPS_0309 OC=Mycobacterium.
Sequence
MVHSIELVFDRDTEAAVRRIWEELAGAGIPSQAPASRPHVTMAVADRISSEVDELLSPVA
ATLPLSCAIGAPVLFGRASVVFARLVVPTVELLALHSEVHRLCAPYLDPAPMPNSLPGHW
TGHVTLARRVGGAQLGRALRIAGRPAQINGSFAGLRRWDGNKRAEQPIT
Download sequence
Identical sequences A0A100HZF3
WP_020787707.1.28311 WP_020787707.1.33562 WP_020787707.1.39490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]