SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101DRL3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101DRL3
Domain Number 1 Region: 5-138
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 1.12e-51
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.00012
Further Details:      
 
Domain Number 2 Region: 140-269
Classification Level Classification E-value
Superfamily Translational machinery components 1.48e-43
Family ERF1/Dom34 middle domain-like 0.00093
Further Details:      
 
Domain Number 3 Region: 272-405
Classification Level Classification E-value
Superfamily L30e-like 1.77e-38
Family ERF1/Dom34 C-terminal domain-like 0.00082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A101DRL3
Sequence length 406
Comment (tr|A0A101DRL3|A0A101DRL3_9EURY) Translation termination factor aRF1 {ECO:0000256|HAMAP-Rule:MF_00424} KW=Complete proteome; Reference proteome OX=1635284 OS=Methanobacteriaceae archaeon 41_258. GN=XD44_0160 OC=Methanobacteriaceae.
Sequence
MGKVSSKKLYEFRRTLEELAEKKGRGTELVSVYIPPDRQISDVTRHMREELSQSANIKSK
QTRKNVQSAIEVIMQRLKLFPRPPENGLVMFVGMIPRGGPGTEKMETYVFEPPEPIKTYI
YHCNSEFYLEPLKEMLEEKEIYGLAVLDRKEATIALLKGKRVEILKTLTSGVPGKHKAGG
QSQRRFDRLIELAAHEFLKRIGDHMNEAFLSIPDLKGIIIGGPGHTKEDFVKGDYLHHEV
KKKIITTVDTSYTGEFGIREVIDKSMDVLTEIDVMREKKLVQRFLSELINEDGLAAYGEE
EVRNYLQMGAVEVLLLSEDLRAKRATYQCPSCNYKMDLTIKREEPRECPKCNDQMKIVDS
KDLIDDLVEIAETVGSEVEIISTETEEGIQLLKAFGGMGAILRYRP
Download sequence
Identical sequences A0A101DRL3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]