SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101EVZ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101EVZ1
Domain Number 1 Region: 1-124
Classification Level Classification E-value
Superfamily MTH1598-like 8.37e-17
Family MTH1598-like 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A101EVZ1
Sequence length 125
Comment (tr|A0A101EVZ1|A0A101EVZ1_9THEM) Uncharacterized protein {ECO:0000313|EMBL:KUK25745.1} KW=Complete proteome; Reference proteome OX=1635260 OS=Thermotoga sp. 50_1627. GN=XD58_0182 OC=Bacteria; Thermotogae; Thermotogales; Thermotogaceae; Thermotoga.
Sequence
MYRQLNHTADVRYEIVCDSEEEIFKELVRIFKDHYSVKFKEQETKLEYDLSKNLEDAVFD
IVNDWIYLIESRKLFPYDCRIENDKLVCTFREFEEIEGTELKALTYHGMDVERSDKIVLR
VVFDT
Download sequence
Identical sequences A0A101EVZ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]