SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101GKX9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101GKX9
Domain Number 1 Region: 85-137
Classification Level Classification E-value
Superfamily NfeD domain-like 0.0000123
Family NfeD domain-like 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A101GKX9
Sequence length 138
Comment (tr|A0A101GKX9|A0A101GKX9_9BACT) Membrane-bound serine protease {ECO:0000313|EMBL:KUK60120.1} KW=Complete proteome; Reference proteome OX=1635292 OS=Bacteroidetes bacterium 38_7. GN=XD81_0435 OC=Bacteria; Bacteroidetes.
Sequence
MVLEILVIPGTSVGGIVALACLGIAIWQSFANYGMTAGLITLGVTLLVSSMALYFSLKSK
TWKRLMLTQENTAKVNVIDEDIVKPGKQGLTISRLAPAGKVEIDGQEYEAHTFGEYMDPG
QKVIVVKIEFNKIYVKSI
Download sequence
Identical sequences A0A101GKX9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]