SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101X9N0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101X9N0
Domain Number 1 Region: 73-144
Classification Level Classification E-value
Superfamily PUA domain-like 0.0000000000000519
Family PUA domain 0.0044
Further Details:      
 
Domain Number 2 Region: 14-71
Classification Level Classification E-value
Superfamily Pre-PUA domain 0.00000032
Family Archaeosine tRNA-guanine transglycosylase, C2 domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A101X9N0
Sequence length 163
Comment (tr|A0A101X9N0|A0A101X9N0_9CREN) Pseudouridine synthase {ECO:0000313|EMBL:KUO87359.1} KW=Complete proteome OX=1714258 OS=Thermoproteus sp. JCHS_4. GN=AT715_06600 OC=Thermoproteaceae; Thermoproteus.
Sequence
MVKSMTPEEHAYGLLTYIYGYKNIDIDKDKIEIKYNKYKRIKYIYYEGRPIFAFRNNDGY
LLPLAEAAPYMKAPYVVVDRETAKFVSQGRSVPAKFIKAYSRGLRPNVEVLVLDEDGKPV
AVGRLLYSMRELTLRRGYAVKPRSRLVEAQSGTRAQTPRRSNA
Download sequence
Identical sequences A0A101X9N0
2013945064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]