SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A101XN59 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A101XN59
Domain Number 1 Region: 15-127
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.33e-32
Family Bacterial S-adenosylmethionine decarboxylase 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A101XN59
Sequence length 130
Comment (tr|A0A101XN59|A0A101XN59_9CREN) Arginine decarboxylase alpha chain {ECO:0000256|HAMAP-Rule:MF_01298} KW=Complete proteome; Reference proteome OX=1714251 OS=Vulcanisaeta sp. CIS_19. GN=AT717_06460 OC=Thermoproteaceae; Vulcanisaeta.
Sequence
MYTIPQLGHERVAGVVGKHIYGNLYDIDPNILKDEDFLRSLVIKAAEIANVHLVEVRSWR
FVNGDKEGVSVIALVVESHIALHTWPVYRFATLDVYTCGDHSMPDKAFNYIISVLRPRRY
TVNYSDRSSD
Download sequence
Identical sequences A0A101XN59
2015231194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]