SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A103Y9J9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A103Y9J9
Domain Number 1 Region: 41-196
Classification Level Classification E-value
Superfamily Chlorophyll a-b binding protein 6.02e-43
Family Chlorophyll a-b binding protein 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A103Y9J9
Sequence length 200
Comment (tr|A0A103Y9J9|A0A103Y9J9_CYNCS) Chlorophyll a-b binding protein, chloroplastic {ECO:0000256|RuleBase:RU363080} OX=59895 OS=Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus). GN=Ccrd_016678 OC=Carduoideae; Cardueae; Carduinae; Cynara.
Sequence
MASNTLMSCGIPAVGRPSLLSSSKSRFAAAVPLSGVATNASRISMTADWMPGQPRPPYLD
GSAPGDFGFDPLRLGEVPENLERFKESELIHCRWAMLAVPGILLPEALGLGNWVKAQEWA
ALPGGQATYLGNPVPWGTLPTILAIEFISIAFVEHQRSMEKDPEKKKYPGGAFDPLGYSK
DPKAFAEYKVKEIKNGNIFA
Download sequence
Identical sequences A0A103Y9J9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]