SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A103YFG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A103YFG9
Domain Number 1 Region: 18-173
Classification Level Classification E-value
Superfamily eIF4e-like 1.14e-52
Family Translation initiation factor eIF4e 0.0000351
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A103YFG9
Sequence length 179
Comment (tr|A0A103YFG9|A0A103YFG9_CYNCS) Eukaryotic translation initiation factor 4E (EIF-4E), conserved site-containing protein {ECO:0000313|EMBL:KVI08114.1} OX=59895 OS=Cynara cardunculus var. scolymus (Globe artichoke) (Cynara scolymus). GN=Ccrd_013519 OC=Carduoideae; Cardueae; Carduinae; Cynara.
Sequence
MASDEAAAVVDVSGEVAGQPHRLDKRWTFWFDNQTKLKQGAAWGNNLRKVFKPSKLPGNA
EFHLFKDGIEPKWEDPQCANGGKWTVTSSRKATLETMWFETLMALIGEQFDDADEICGVV
ASVRQKQDKLSLWTKNAANEAAQMAIGRKWKDIIDVNDKITYNFHDDSKTRASKGRYSV
Download sequence
Identical sequences A0A103YFG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]